Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR85 Peptide - N-terminal region

WDR85 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C9orf112, RP11-48C7.3, RRT2, WDR85

UniProt

Q9BTV6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR85 Rabbit Polyclonal Antibody (orb587192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620133

Preservative

Lyophilized powder

AA Sequence

CPLQGCRHLLACGTYQLRRPEDRPAGPQNKGGMEVKEPQVRLGRLFLYSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GM2/GD2 Synthase discontinued
389609 200 µL

GM2/GD2 Synthase discontinued

Sign In for Pricing
View Details
Rabbit Anti-Human ARFGEF2 pAb
PA9028-01 50 μL

Rabbit Anti-Human ARFGEF2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human ARFGEF2 pAb
PA9028-02 100 μL

Rabbit Anti-Human ARFGEF2 pAb

Sign In for Pricing
View Details
Tau (Tau Protein, Microtubule-associated Protein, MAP) (MaxLight 490)
T1030-ML490 100 µL

Tau (Tau Protein, Microtubule-associated Protein, MAP) (MaxLight 490)

Sign In for Pricing
View Details
Rabies virus (RABV) (strain CVS-11) Glycoprotein (His & Myc & SUMO)
TMPH-03221-01 5 µg

Rabies virus (RABV) (strain CVS-11) Glycoprotein (His & Myc & SUMO)

Sign In for Pricing
View Details
Rabies virus (RABV) (strain CVS-11) Glycoprotein (His & Myc & SUMO)
TMPH-03221-02 10 µg

Rabies virus (RABV) (strain CVS-11) Glycoprotein (His & Myc & SUMO)

Sign In for Pricing
View Details