Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR85 Peptide - N-terminal region

WDR85 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C9orf112, RP11-48C7.3, RRT2, WDR85

UniProt

Q9BTV6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR85 Rabbit Polyclonal Antibody (orb587192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620133

Preservative

Lyophilized powder

AA Sequence

CPLQGCRHLLACGTYQLRRPEDRPAGPQNKGGMEVKEPQVRLGRLFLYSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Glu-OMe
4011104.0001 1 g

H-Glu-OMe

Sign In for Pricing
View Details
JMY sgRNA CRISPR Lentivector (Human) (Target 1)
K1111702 1.0 µg DNA

JMY sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GLRX3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
21624154 3x 1.0 µg DNA

GLRX3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
ST6GAL2 siRNA (Human)
CRJ3536-01 15 nmol

ST6GAL2 siRNA (Human)

Sign In for Pricing
View Details
ST6GAL2 siRNA (Human)
CRJ3536-02 30 nmol

ST6GAL2 siRNA (Human)

Sign In for Pricing
View Details
PRKXP1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1723602 1.0 µg DNA

PRKXP1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details