Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR8 Peptide - N-terminal region

ACTR8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARP8, INO80N, hArp8

UniProt

Q9H981

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTR8 Rabbit Polyclonal Antibody (orb326854) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075050

Preservative

Lyophilized powder

AA Sequence

MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ORP150/HSP12A Antibody (6E3-2C3) [DyLight 488]
NBP2-59345G 100 µL

Mouse Monoclonal ORP150/HSP12A Antibody (6E3-2C3) [DyLight 488]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS511097 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Mouse Monoclonal PDLIM1 Antibody (CPTC-PDLIM1-1) [CoraFluor 1]
NBP3-08842CL1 0.1 mL

Mouse Monoclonal PDLIM1 Antibody (CPTC-PDLIM1-1) [CoraFluor 1]

Sign In for Pricing
View Details
RANTES (Regulated on Activation, Normal T-cell Expressed and Secreted) (MaxLight 750) discontinued
R1100-13A-ML750 100 µL

RANTES (Regulated on Activation, Normal T-cell Expressed and Secreted) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Biotin-Linked Anti-Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
FY-AB43044-01 1 mL

Biotin-Linked Anti-Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing
View Details
Biotin-Linked Anti-Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
FY-AB43044-02 100 µL

Biotin-Linked Anti-Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing
View Details