ACTR8 Peptide - N-terminal region
ACTR8 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ARP8, INO80N, hArp8
UniProt
Q9H981
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACTR8 Rabbit Polyclonal Antibody (orb326854) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_075050
Preservative
Lyophilized powder
AA Sequence
MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PA1425-Fluoro488 100 µg/Vial
Anti-Carbonic Anhydrase I/CA1 Antibody Picoband® Fluoro488 Conjugated
Sign In for Pricing
View Details 
MBS6435874-01 0.1 mL
ROCK2 (Rho-associated Coiled-coil-containing Protein Kinase 2, ROCK-II, KIAA0619) (MaxLight 490)
Sign In for Pricing
View Details MBS6435874-02 5x 0.1 mL
ROCK2 (Rho-associated Coiled-coil-containing Protein Kinase 2, ROCK-II, KIAA0619) (MaxLight 490)
Sign In for Pricing
View Details orb1358802 100 µg
Integrin beta 7 (ITGB7) Human Over-expression Lysate
Sign In for Pricing
View Details