Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASC4 Peptide - middle region

CASC4 Peptide - middle region

Product Specifications

Product Name Alternative

H63

UniProt

A8K4R1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASC4 Rabbit Polyclonal Antibody (orb587201) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_816929

Preservative

Lyophilized powder

AA Sequence

FQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQV

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKAP4 Antibody
orb253836 100 µL

CKAP4 Antibody

Sign In for Pricing
View Details
Mouse Ppp2r3c qPCR Primer Pair
QM30182S 200 Tests

Mouse Ppp2r3c qPCR Primer Pair

Sign In for Pricing
View Details
EDA-GTPγS-ATTO-565
NU-1610-565 50 μL

EDA-GTPγS-ATTO-565

Sign In for Pricing
View Details
Rat VEGF Co Regulated Chemokine 1 (VCC1) ELISA Kit
RD-VCC1-Ra-48Tests 48 Tests

Rat VEGF Co Regulated Chemokine 1 (VCC1) ELISA Kit

Sign In for Pricing
View Details
Tmem151a Knockout HT22 Cell Line
ARG44159 1 Million

Tmem151a Knockout HT22 Cell Line

Sign In for Pricing
View Details
Recombinant Human SAE1 Protein, GST, E.coli-100ug
QP8183-ec-100ug 100ug

Recombinant Human SAE1 Protein, GST, E.coli-100ug

Sign In for Pricing
View Details