Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASC4 Peptide - middle region

CASC4 Peptide - middle region

Product Specifications

Product Name Alternative

H63

UniProt

A8K4R1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASC4 Rabbit Polyclonal Antibody (orb587201) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_816929

Preservative

Lyophilized powder

AA Sequence

FQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Anti-Caspase 6 (CASP6)
FY-AB41508-01 1 mL

Biotin-Linked Anti-Caspase 6 (CASP6)

Sign In for Pricing
View Details
Biotin-Linked Anti-Caspase 6 (CASP6)
FY-AB41508-02 100 µL

Biotin-Linked Anti-Caspase 6 (CASP6)

Sign In for Pricing
View Details
Biotin-Linked Anti-Caspase 6 (CASP6)
FY-AB41508-03 200 µL

Biotin-Linked Anti-Caspase 6 (CASP6)

Sign In for Pricing
View Details
HHV-8 glycoproteinB/gB Recombinant Protein (N-His)
VK084022-01 50 µg

HHV-8 glycoproteinB/gB Recombinant Protein (N-His)

Sign In for Pricing
View Details
HHV-8 glycoproteinB/gB Recombinant Protein (N-His)
VK084022-02 100 µg

HHV-8 glycoproteinB/gB Recombinant Protein (N-His)

Sign In for Pricing
View Details
HHV-8 glycoproteinB/gB Recombinant Protein (N-His)
VK084022-03 1 mg

HHV-8 glycoproteinB/gB Recombinant Protein (N-His)

Sign In for Pricing
View Details