Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYSMD3 Peptide - C-terminal region

LYSMD3 Peptide - C-terminal region

Product Specifications

UniProt

Q7Z3D4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYSMD3 Rabbit Polyclonal Antibody (orb587205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_938014

Preservative

Lyophilized powder

AA Sequence

SHLHSKITPPSQQREMENGIVPTKGIHFSQQDDHKLYSQDSQSPAAQQET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calprotectin (MRP14) (S100A9) (CPT/1028), 0.2mg/mL
BNUB1028-100 1x 100 µL

Calprotectin (MRP14) (S100A9) (CPT/1028), 0.2mg/mL

Sign In for Pricing
View Details
Chromogranin C (SCG2) Mouse Monoclonal Antibody [Clone ID: OTI3F12]
CF811982 100 µg

Chromogranin C (SCG2) Mouse Monoclonal Antibody [Clone ID: OTI3F12]

Sign In for Pricing
View Details
Human OR52I1 activation kit by CRISPRa
GA118095 1 Kit

Human OR52I1 activation kit by CRISPRa

Sign In for Pricing
View Details
Desi1 (NM_134095) Mouse Tagged ORF Clone
MG201395 10 µg

Desi1 (NM_134095) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
p63 (TP63) (NM_001114978) Human Over-expression Lysate
LC426514 20 µg

p63 (TP63) (NM_001114978) Human Over-expression Lysate

Sign In for Pricing
View Details
TSPAN7 Antibody
KC-3943-01 50 μL

TSPAN7 Antibody

Sign In for Pricing
View Details