Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYSMD3 Peptide - C-terminal region

LYSMD3 Peptide - C-terminal region

Product Specifications

UniProt

Q7Z3D4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYSMD3 Rabbit Polyclonal Antibody (orb587205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_938014

Preservative

Lyophilized powder

AA Sequence

SHLHSKITPPSQQREMENGIVPTKGIHFSQQDDHKLYSQDSQSPAAQQET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX8 (Renal Cell Marker) (PAX8/2774R), CF488A conjugate, 0.1mg/mL
BNC882774-500 1x 500 µL

PAX8 (Renal Cell Marker) (PAX8/2774R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hexokinase II (HK2) (NM_000189) Human Recombinant Protein
TP309482L 1 mg

Hexokinase II (HK2) (NM_000189) Human Recombinant Protein

Sign In for Pricing
View Details
Alverine Citrate
TRC-A575780-5G 5 g

Alverine Citrate

Sign In for Pricing
View Details
c Fos (FOS) (NM_005252) Human Over-expression Lysate
LC401614 20 µg

c Fos (FOS) (NM_005252) Human Over-expression Lysate

Sign In for Pricing
View Details
SEPHS1 Polyclonal Antibody
E-AB-53184-01 20 µL

SEPHS1 Polyclonal Antibody

Sign In for Pricing
View Details
SEPHS1 Polyclonal Antibody
E-AB-53184-02 60 µL

SEPHS1 Polyclonal Antibody

Sign In for Pricing
View Details