Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GINM1 Peptide - middle region

GINM1 Peptide - middle region

Product Specifications

Product Name Alternative

C6orf72, dJ12G14.2

UniProt

Q9NU53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GINM1 Rabbit Polyclonal Antibody (orb326857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620140

Preservative

Lyophilized powder

AA Sequence

SVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQQKDVTEIDILVKNRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), Biotin conjugate, 0.1mg/mL
BNCB1366-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2579), CF488A conjugate, 0.1mg/mL
BNC882579-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2579), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Pivaloylaniline
TRC-P550665-1G 1 g

N-Pivaloylaniline

Sign In for Pricing
View Details
Glucoamylase Microplate Assay Kit
RDSM221 100 Assays

Glucoamylase Microplate Assay Kit

Sign In for Pricing
View Details
RREB1 (NM_001003699) Human Over-expression Lysate
LC423986 20 µg

RREB1 (NM_001003699) Human Over-expression Lysate

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-35 50 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details