Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GINM1 Peptide - middle region

GINM1 Peptide - middle region

Product Specifications

Product Name Alternative

C6orf72, dJ12G14.2

UniProt

Q9NU53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GINM1 Rabbit Polyclonal Antibody (orb326857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620140

Preservative

Lyophilized powder

AA Sequence

SVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQQKDVTEIDILVKNRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAF1 (POLR1E) (NM_022490) Human Over-expression Lysate
LY402928 100 µg

PRAF1 (POLR1E) (NM_022490) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD14 Antibody[UCHM-1]
AN00420P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD14 Antibody[UCHM-1]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD14 Antibody[UCHM-1]
AN00420P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD14 Antibody[UCHM-1]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD14 Antibody[UCHM-1]
AN00420P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Human CD14 Antibody[UCHM-1]

Sign In for Pricing
View Details
X-GAL, 1 g
#10011-1 1x 1 g

X-GAL, 1 g

Sign In for Pricing
View Details
FGF13 Polyclonal Antibody
E-AB-19868-01 20 µL

FGF13 Polyclonal Antibody

Sign In for Pricing
View Details