Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGAP4 Peptide - C-terminal region

AGAP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTGLF1, MRIP2

UniProt

Q96P64

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGAP4 Rabbit Polyclonal Antibody (orb587210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_597703

Preservative

Lyophilized powder

AA Sequence

WPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEKERWIRSKYEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPHB1 (Center) (Mouse) Rabbit pAb
MBS8556271-01 0.1 mL

EPHB1 (Center) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
EPHB1 (Center) (Mouse) Rabbit pAb
MBS8556271-02 0.1 mL (AF405L)

EPHB1 (Center) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
EPHB1 (Center) (Mouse) Rabbit pAb
MBS8556271-03 0.1 mL (AF405S)

EPHB1 (Center) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
EPHB1 (Center) (Mouse) Rabbit pAb
MBS8556271-04 0.1 mL (AF610)

EPHB1 (Center) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
EPHB1 (Center) (Mouse) Rabbit pAb
MBS8556271-05 0.1 mL (AF635)

EPHB1 (Center) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
EPHB1 (Center) (Mouse) Rabbit pAb
MBS8556271-06 0.1 mL (APC)

EPHB1 (Center) (Mouse) Rabbit pAb

Sign In for Pricing
View Details