Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGAP4 Peptide - C-terminal region

AGAP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTGLF1, MRIP2

UniProt

Q96P64

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGAP4 Rabbit Polyclonal Antibody (orb587210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_597703

Preservative

Lyophilized powder

AA Sequence

WPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEKERWIRSKYEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC Class I (MaxLight 550)
MBS6255143-01 0.1 mL

MHC Class I (MaxLight 550)

Sign In for Pricing
View Details
MHC Class I (MaxLight 550)
MBS6255143-02 5x 0.1 mL

MHC Class I (MaxLight 550)

Sign In for Pricing
View Details
Hnrpa3 (BC085474) Mouse Tagged ORF Clone
MR204450 10 µg

Hnrpa3 (BC085474) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
VWF (3E2D10) : m-IgG1 BP-HRP Bundle
sc-544755 1 Kit

VWF (3E2D10) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Orexin-A, Recombinant, Human, TRX, His-Tag discontinued
591341-01 20 µg

Orexin-A, Recombinant, Human, TRX, His-Tag discontinued

Sign In for Pricing
View Details
Orexin-A, Recombinant, Human, TRX, His-Tag discontinued
591341-02 100 µg

Orexin-A, Recombinant, Human, TRX, His-Tag discontinued

Sign In for Pricing
View Details