Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNLIPRP3 Peptide - C-terminal region

PNLIPRP3 Peptide - C-terminal region

Product Specifications

UniProt

Q17RR3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PNLIPRP3 Rabbit Polyclonal Antibody (orb587212) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011709

Preservative

Lyophilized powder

AA Sequence

IVSGKLEPGMTYTKLIDADVNVGNITSVQFIWKKHLFEDSQNKLGAEMVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-500 1x 500 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-500 1x 500 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TOX3 (TOX3/1123), CF568 conjugate, 0.1mg/mL
BNC681123-500 1x 500 µL

TOX3 (TOX3/1123), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mesothelin (Mesothelial Marker) (MSLN/2131), CF640R conjugate, 0.1mg/mL
BNC402131-100 1x 100 µL

Mesothelin (Mesothelial Marker) (MSLN/2131), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details