Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIH1D2 Peptide - N-terminal region

PIH1D2 Peptide - N-terminal region

Product Specifications

UniProt

E9PD82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIH1D2 Rabbit Polyclonal Antibody (orb587214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001076088

Preservative

Lyophilized powder

AA Sequence

SKGLLTQVTQFWNLLDDLAQSDPEGYEKFIQQQLKEGKQLCAAPEPQLCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH6 (DNA Mismatch Repair Protein) (MSH6/2111), CF568 conjugate, 0.1mg/mL
BNC682111-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/2111), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B4galt4 (NM_019804) Mouse Over-expression Lysate
LY705179 100 µg

B4galt4 (NM_019804) Mouse Over-expression Lysate

Sign In for Pricing
View Details
Fluorescein-Phalloidin
#00030 1x 300 U

Fluorescein-Phalloidin

Sign In for Pricing
View Details
Texas Red Conjugated Arum maculatum Lectin (Lords and Ladies) -AMA-
T-8012-1 1 mg

Texas Red Conjugated Arum maculatum Lectin (Lords and Ladies) -AMA-

Sign In for Pricing
View Details
Tapasin (TAPBP) (N-term) Rabbit Polyclonal Antibody
AP46045PU-N 100 µL

Tapasin (TAPBP) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Parotid gland
CS800350 5x 5 µm

Tissue FFPE Sections, Parotid gland

Sign In for Pricing
View Details