Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIH1D2 Peptide - N-terminal region

PIH1D2 Peptide - N-terminal region

Product Specifications

UniProt

E9PD82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIH1D2 Rabbit Polyclonal Antibody (orb587214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001076088

Preservative

Lyophilized powder

AA Sequence

SKGLLTQVTQFWNLLDDLAQSDPEGYEKFIQQQLKEGKQLCAAPEPQLCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Supt4a Mouse Gene Knockout Kit (CRISPR)
KN516991 1 Kit

Supt4a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB511126 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Human Adrenergic Receptor Beta 3 (ADRb3) ELISA Kit
RD-ADRb3-Hu-01 96 Tests

Human Adrenergic Receptor Beta 3 (ADRb3) ELISA Kit

Sign In for Pricing
View Details
Human Adrenergic Receptor Beta 3 (ADRb3) ELISA Kit
RD-ADRb3-Hu-02 48 Tests

Human Adrenergic Receptor Beta 3 (ADRb3) ELISA Kit

Sign In for Pricing
View Details
Sh3bp2 Mouse Gene Knockout Kit (CRISPR)
KN515713 1 Kit

Sh3bp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LAMC2 (NM_005562) Human Over-expression Lysate
LY429255 100 µg

LAMC2 (NM_005562) Human Over-expression Lysate

Sign In for Pricing
View Details