Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLBA1 Peptide - N-terminal region

CLBA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C14orf79

UniProt

Q96F83

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLBA1 Rabbit Polyclonal Antibody (orb326861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777551

Preservative

Lyophilized powder

AA Sequence

CTARCPDPGEHSSTWGEFEGFRESSAKSGQFSQSLELLEGPTEPQPPRTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FZD9 Rabbit Polyclonal Antibody (FITC)
orb399772 100 µg

FZD9 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Buffered Peptone Water (ISO)
MED1032 10 / PCK

Buffered Peptone Water (ISO)

Sign In for Pricing
View Details
Human FAM114A1 siRNA
abx915989-01 15 nmol

Human FAM114A1 siRNA

Sign In for Pricing
View Details
Human FAM114A1 siRNA
abx915989-02 30 nmol

Human FAM114A1 siRNA

Sign In for Pricing
View Details
Mouse Monoclonal DC-SIGN/CD209 Antibody (MM0239-4G10) [Alexa Fluor 488]
NBP2-12150AF488 0.1 mL

Mouse Monoclonal DC-SIGN/CD209 Antibody (MM0239-4G10) [Alexa Fluor 488]

Sign In for Pricing
View Details
Nkx2-8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
31886116 3x 1.0 µg

Nkx2-8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details