Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLBA1 Peptide - N-terminal region

CLBA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C14orf79

UniProt

Q96F83

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLBA1 Rabbit Polyclonal Antibody (orb326861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777551

Preservative

Lyophilized powder

AA Sequence

CTARCPDPGEHSSTWGEFEGFRESSAKSGQFSQSLELLEGPTEPQPPRTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myt1 Rabbit Polyclonal Antibody (PE-Cy5)
orb887275 100 µL

Myt1 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
SULT4A1b Antibody Blocking peptide
orb1450799 500 µg

SULT4A1b Antibody Blocking peptide

Sign In for Pricing
View Details
Human Transcription Termination Factor, RNA polymerase I (TTF1) ELISA Kit
RD-TTF1-Hu-01 96 Tests

Human Transcription Termination Factor, RNA polymerase I (TTF1) ELISA Kit

Sign In for Pricing
View Details
Human Transcription Termination Factor, RNA polymerase I (TTF1) ELISA Kit
RD-TTF1-Hu-02 48 Tests

Human Transcription Termination Factor, RNA polymerase I (TTF1) ELISA Kit

Sign In for Pricing
View Details
ZNF234 siRNA (Human)
CRH7345-01 15 nmol

ZNF234 siRNA (Human)

Sign In for Pricing
View Details
ZNF234 siRNA (Human)
CRH7345-02 30 nmol

ZNF234 siRNA (Human)

Sign In for Pricing
View Details