Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC173 Peptide - C-terminal region

CCDC173 Peptide - C-terminal region

Product Specifications

UniProt

Q0VFZ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC173 Rabbit Polyclonal Antibody (orb326865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078916

Preservative

Lyophilized powder

AA Sequence

ADQIFWEHEKEKKCKADKEHQEVQDAHIQQMAKNKFNAKQAKQAELDYCR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3 beta (GSK3B) Human Gene Knockout Kit (CRISPR)
KN200468 1 Kit

GSK3 beta (GSK3B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS627033 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), 1mg/mL
BNUM0266-50 1x 50 µL

Human IgG Immunoglobulin (IG266), 1mg/mL

Sign In for Pricing
View Details
IFluor® 700 Styramide
45055-AAT 100 Slides

IFluor® 700 Styramide

Sign In for Pricing
View Details
Mouse Cdh23 activation kit by CRISPRa
GA204569 1 Kit

Mouse Cdh23 activation kit by CRISPRa

Sign In for Pricing
View Details
Iso Imperatorin
TRC-I820150-10MG 10 mg

Iso Imperatorin

Sign In for Pricing
View Details