Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC173 Peptide - C-terminal region

CCDC173 Peptide - C-terminal region

Product Specifications

UniProt

Q0VFZ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC173 Rabbit Polyclonal Antibody (orb326865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078916

Preservative

Lyophilized powder

AA Sequence

ADQIFWEHEKEKKCKADKEHQEVQDAHIQQMAKNKFNAKQAKQAELDYCR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,5-Dehydro-corticosterone 21-Acetate
TRC-D477075-500MG 500 mg

4,5-Dehydro-corticosterone 21-Acetate

Sign In for Pricing
View Details
VEGFA (NM_001025370) Human Over-expression Lysate
LY422439 100 µg

VEGFA (NM_001025370) Human Over-expression Lysate

Sign In for Pricing
View Details
SPANXB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D10]
TA811404AM 100 µL

SPANXB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D10]

Sign In for Pricing
View Details
FEM 1B (FEM1B) Rabbit Polyclonal Antibody
TA371346 100 µL

FEM 1B (FEM1B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL 24 Human
OM296614-01 10 µg

IL 24 Human

Sign In for Pricing
View Details
IL 24 Human
OM296614-02 2 µg

IL 24 Human

Sign In for Pricing
View Details