Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM174 Peptide - C-terminal region

TMEM174 Peptide - C-terminal region

Product Specifications

UniProt

Q8WUU8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM174 Rabbit Polyclonal Antibody (orb587220) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694949

Preservative

Lyophilized powder

AA Sequence

VVDEGCLSFTDGGNHRPNPDVDQLEETQLEEEACACFSPPPYEEIYSLPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody
AP02617PU-S 50 µL

VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl 4-Chloro-6-((6-chloro-3-(ethoxycarbonyl)pyridazin-4-yl)amino)pyridazine-3-carboxylate
TRC-E335350-100MG 100 mg

Ethyl 4-Chloro-6-((6-chloro-3-(ethoxycarbonyl)pyridazin-4-yl)amino)pyridazine-3-carboxylate

Sign In for Pricing
View Details
SNAIL (SNAI1) (NM_005985) Human Over-expression Lysate
LY401811 100 µg

SNAIL (SNAI1) (NM_005985) Human Over-expression Lysate

Sign In for Pricing
View Details
TSTD1 Human Gene Knockout Kit (CRISPR)
KN424992 1 Kit

TSTD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAI3 (GPRC5A) Rabbit Polyclonal Antibody
AP01430PU-N 100 µg

RAI3 (GPRC5A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sash3 Mouse Gene Knockout Kit (CRISPR)
KN515306 1 Kit

Sash3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details