TMEM174 Peptide - C-terminal region
TMEM174 Peptide - C-terminal region
Product Specifications
UniProt
Q8WUU8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM174 Rabbit Polyclonal Antibody (orb587220) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_694949
Preservative
Lyophilized powder
AA Sequence
VVDEGCLSFTDGGNHRPNPDVDQLEETQLEEEACACFSPPPYEEIYSLPR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682752-500 1x 500 µL
Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2752), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Sex Hormone Binding Globulin (SHBG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G2]](https://cdn.genprice.uk/products/937/68dd1b73061270361ea191d0/imageurl/ta507184bm.webp)
TA507184BM 100 µL
Sex Hormone Binding Globulin (SHBG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G2]
Sign In for Pricing
View Details 
