Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC155 Peptide - C-terminal region

CCDC155 Peptide - C-terminal region

Product Specifications

UniProt

Q8N6L0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC155 Rabbit Polyclonal Antibody (orb587233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653289

Preservative

Lyophilized powder

AA Sequence

VIHETSEETEFPSEAPAGGQRNFQGEPAHPEEGRKEPSMWLTRREEEEDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary
CS700182 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
PBK Rabbit Monoclonal Antibody [Clone ID: R05-1B6]
TA384935 100 µL

PBK Rabbit Monoclonal Antibody [Clone ID: R05-1B6]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081H-01 50 Tests

PE/Cyanine7 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081H-02 100 Tests

PE/Cyanine7 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
TESK2 Polyclonal Antibody
E-AB-66062-01 60 µL

TESK2 Polyclonal Antibody

Sign In for Pricing
View Details