Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC155 Peptide - C-terminal region

CCDC155 Peptide - C-terminal region

Product Specifications

UniProt

Q8N6L0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC155 Rabbit Polyclonal Antibody (orb587233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653289

Preservative

Lyophilized powder

AA Sequence

VIHETSEETEFPSEAPAGGQRNFQGEPAHPEEGRKEPSMWLTRREEEEDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEAK7 (TLDC1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B1]
TA501057AM 100 µL

MEAK7 (TLDC1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B1]

Sign In for Pricing
View Details
PQBP1 (NM_001032383) Human Over-expression Lysate
LC422319 20 µg

PQBP1 (NM_001032383) Human Over-expression Lysate

Sign In for Pricing
View Details
Akap17b Mouse Gene Knockout Kit (CRISPR)
KN501067 1 Kit

Akap17b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RGS10 (NM_002925) Human Over-expression Lysate
LY419006 100 µg

RGS10 (NM_002925) Human Over-expression Lysate

Sign In for Pricing
View Details
Pan-Actin Recombinant Mouse Monoclonal Antibody [A2E1-R]
HA601287 100 µL

Pan-Actin Recombinant Mouse Monoclonal Antibody [A2E1-R]

Sign In for Pricing
View Details
ANKRD30B Human Gene Knockout Kit (CRISPR)
KN427385 1 Kit

ANKRD30B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details