Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCSAML Peptide - N-terminal region

GCSAML Peptide - N-terminal region

Product Specifications

UniProt

Q5JQS6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCSAML Rabbit Polyclonal Antibody (orb326876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660321

Preservative

Lyophilized powder

AA Sequence

ENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1501 (NM_001000715) Rat Tagged ORF Clone Lentiviral Particle
RR207042L3V 200 µL

Olr1501 (NM_001000715) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Keratinocyte differentiation associated protein (KRTDAP) CytoSection
TS423306P5 25 Slides

Keratinocyte differentiation associated protein (KRTDAP) CytoSection

Sign In for Pricing
View Details
Bovine Peptidyl-prolyl cis-trans isomerase FKBP10, FKBP10 ELISA Kit
MBS9330992-01 48 Well

Bovine Peptidyl-prolyl cis-trans isomerase FKBP10, FKBP10 ELISA Kit

Sign In for Pricing
View Details
Bovine Peptidyl-prolyl cis-trans isomerase FKBP10, FKBP10 ELISA Kit
MBS9330992-02 96 Well

Bovine Peptidyl-prolyl cis-trans isomerase FKBP10, FKBP10 ELISA Kit

Sign In for Pricing
View Details
Bovine Peptidyl-prolyl cis-trans isomerase FKBP10, FKBP10 ELISA Kit
MBS9330992-03 5x 96 Well

Bovine Peptidyl-prolyl cis-trans isomerase FKBP10, FKBP10 ELISA Kit

Sign In for Pricing
View Details
Bovine Peptidyl-prolyl cis-trans isomerase FKBP10, FKBP10 ELISA Kit
MBS9330992-04 10x 96 Well

Bovine Peptidyl-prolyl cis-trans isomerase FKBP10, FKBP10 ELISA Kit

Sign In for Pricing
View Details