Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCSAML Peptide - N-terminal region

GCSAML Peptide - N-terminal region

Product Specifications

UniProt

Q5JQS6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCSAML Rabbit Polyclonal Antibody (orb326877) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660321

Preservative

Lyophilized powder

AA Sequence

DEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEVCYTVINH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC52 Protein Lysate (Human) with C-Ha Tag
15276031 100 µg

CCDC52 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Porcine Anti-Rabies Virus Antibody AntI-RV ELISA Kit
BG-POR10294 1 Each

Porcine Anti-Rabies Virus Antibody AntI-RV ELISA Kit

Sign In for Pricing
View Details
Caspase 8 Antibody FITC Conjugated
C00037F 100 µL

Caspase 8 Antibody FITC Conjugated

Sign In for Pricing
View Details
Human HEAT repeat-containing protein 5B, HEATR5B ELISA Kit
MBS9340644-01 48 Well

Human HEAT repeat-containing protein 5B, HEATR5B ELISA Kit

Sign In for Pricing
View Details
Human HEAT repeat-containing protein 5B, HEATR5B ELISA Kit
MBS9340644-02 96 Well

Human HEAT repeat-containing protein 5B, HEATR5B ELISA Kit

Sign In for Pricing
View Details
Human HEAT repeat-containing protein 5B, HEATR5B ELISA Kit
MBS9340644-03 5x 96 Well

Human HEAT repeat-containing protein 5B, HEATR5B ELISA Kit

Sign In for Pricing
View Details