Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCSAML Peptide - N-terminal region

GCSAML Peptide - N-terminal region

Product Specifications

UniProt

Q5JQS6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCSAML Rabbit Polyclonal Antibody (orb326877) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660321

Preservative

Lyophilized powder

AA Sequence

DEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEVCYTVINH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC6A6 3'UTR GFP Stable Cell Line
TU073321 1.0 mL

SLC6A6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PFK-1 CRISPR Activation Plasmid (r2)
sc-437376-ACT-2 20 µg

PFK-1 CRISPR Activation Plasmid (r2)

Sign In for Pricing
View Details
Mouse Monoclonal Desmoglein-3 Antibody (rDSG3/8611) [Alexa Fluor 647]
NBP3-24060AF647 0.1 mL

Mouse Monoclonal Desmoglein-3 Antibody (rDSG3/8611) [Alexa Fluor 647]

Sign In for Pricing
View Details
IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (PE)
MBS6452564-01 0.1 mL

IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (PE)

Sign In for Pricing
View Details
IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (PE)
MBS6452564-02 5x 0.1 mL

IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (PE)

Sign In for Pricing
View Details
RPL22 Blocking Peptide
CBP4210-01 1 mg

RPL22 Blocking Peptide

Sign In for Pricing
View Details