Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD19 Peptide - C-terminal region

BTBD19 Peptide - C-terminal region

Product Specifications

UniProt

C9JJ37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTBD19 Rabbit Polyclonal Antibody (orb587235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001130009

Preservative

Lyophilized powder

AA Sequence

LERPVAEVAAPVVKELRLALLAPAELSALEEQNRQEPLIPVEQIVEAWKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1216 Mouse qPCR Primer Pair (NM_146893)
MP209438 200 Reactions

Olfr1216 Mouse qPCR Primer Pair (NM_146893)

Sign In for Pricing
View Details
CD200 (Cluster Of Differentiation 200, MOX1, MOX2, MRC, OX-2, My033, Antigen Identified By Monoclonal Antibody MRC OX-2)
362454 200 µL

CD200 (Cluster Of Differentiation 200, MOX1, MOX2, MRC, OX-2, My033, Antigen Identified By Monoclonal Antibody MRC OX-2)

Sign In for Pricing
View Details
LRRC50 Over-expression Lysate Product
GWB-E49490 0.1 mg

LRRC50 Over-expression Lysate Product

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) Ubiquitin-like protein SMT3
MBS1344450-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) Ubiquitin-like protein SMT3

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) Ubiquitin-like protein SMT3
MBS1344450-02 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) Ubiquitin-like protein SMT3

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) Ubiquitin-like protein SMT3
MBS1344450-03 1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) Ubiquitin-like protein SMT3

Sign In for Pricing
View Details