Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC13 Peptide - N-terminal region

CCDC13 Peptide - N-terminal region

Product Specifications

UniProt

Q8IYE1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC13 Rabbit Polyclonal Antibody (orb587238) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653320

Preservative

Lyophilized powder

AA Sequence

RLQFKAMQEMQHKRLQKQMEKKREKELSLKSRADDQEEPLEVSDGLSLLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Water Chiller BCHI-202
BCHI-202 Each

Water Chiller BCHI-202

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF640R conjugate, 0.1mg/mL
BNC402453-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Glra1 activation kit by CRISPRa
GA201635 1 Kit

Mouse Glra1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Pleura
CS708280 5x 5 µm

Tissue FFPE Sections, Pleura

Sign In for Pricing
View Details
IFluor® 460 Styramide
44902-AAT 100 Slides

IFluor® 460 Styramide

Sign In for Pricing
View Details
Lysozyme (LYZ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D8]
TA506192AM 100 µL

Lysozyme (LYZ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D8]

Sign In for Pricing
View Details