Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC13 Peptide - N-terminal region

CCDC13 Peptide - N-terminal region

Product Specifications

UniProt

Q8IYE1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC13 Rabbit Polyclonal Antibody (orb587238) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653320

Preservative

Lyophilized powder

AA Sequence

RLQFKAMQEMQHKRLQKQMEKKREKELSLKSRADDQEEPLEVSDGLSLLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Haptoglobin (HP) Human Gene Knockout Kit (CRISPR)
KN423612 1 Kit

Haptoglobin (HP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Holmium(III) Oxide
TRC-H669633-5G 5 g

Holmium(III) Oxide

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS704154 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Tyrosinase (Melanoma Marker) (rOCA1/812), CF647 conjugate, 0.1mg/mL
BNC472215-100 1x 100 µL

Tyrosinase (Melanoma Marker) (rOCA1/812), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BRAF35 (HMG20B) Rabbit Polyclonal Antibody
AP06758PU-N 100 µg

BRAF35 (HMG20B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-[1-(2-Naphthyl)ethyl]benzoic Acid
TRC-N372050-500MG 500 mg

2-[1-(2-Naphthyl)ethyl]benzoic Acid

Sign In for Pricing
View Details