Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Peptide - middle region

Prrxl1 Peptide - middle region

Product Specifications

Product Name Alternative

Drg11, Drgx, Prrxl1

UniProt

Q62798

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrxl1 Rabbit Polyclonal Antibody (orb324661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665710

Preservative

Lyophilized powder

AA Sequence

GAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPEG Antibody
orb863416 2 mg

SPEG Antibody

Sign In for Pricing
View Details
AdmiRa-hsa-mir-5696 Virus
mh1423 250 µL

AdmiRa-hsa-mir-5696 Virus

Sign In for Pricing
View Details
Human Apolipoprotein A-V (Apo A5) AssayLite™ Antibody (APC Conjugate)
32139-05161 5x 30 µg

Human Apolipoprotein A-V (Apo A5) AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
Penfluridol (Standard)
HY-B1077R-01 5 mg

Penfluridol (Standard)

Sign In for Pricing
View Details
Penfluridol (Standard)
HY-B1077R-02 10 mg

Penfluridol (Standard)

Sign In for Pricing
View Details
Penfluridol (Standard)
HY-B1077R-03 25 mg

Penfluridol (Standard)

Sign In for Pricing
View Details