Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Peptide - middle region

Prrxl1 Peptide - middle region

Product Specifications

Product Name Alternative

Drg11, Drgx, Prrxl1

UniProt

Q62798

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrxl1 Rabbit Polyclonal Antibody (orb324661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665710

Preservative

Lyophilized powder

AA Sequence

GAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N20C hydrochloride
sc-204116A 50 mg

N20C hydrochloride

Sign In for Pricing
View Details
Recombinant Suid herpesvirus 1 Glycoprotein K (gK), partial
MBS7091601 Inquire

Recombinant Suid herpesvirus 1 Glycoprotein K (gK), partial

Sign In for Pricing
View Details
IL13RA1 Conjugated Antibody
orb1626126 100 µL

IL13RA1 Conjugated Antibody

Sign In for Pricing
View Details
AQP7 Conjugated Antibody
C43226 100 µL

AQP7 Conjugated Antibody

Sign In for Pricing
View Details
GENLISA™ Human Protein Kinase C Delta (PKCδ1) ELISA
KBH22027 96 Well

GENLISA™ Human Protein Kinase C Delta (PKCδ1) ELISA

Sign In for Pricing
View Details
HTF34 Double Nickase Plasmid (h)
sc-413459-NIC 20 µg

HTF34 Double Nickase Plasmid (h)

Sign In for Pricing
View Details