Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Peptide - middle region

Prrxl1 Peptide - middle region

Product Specifications

Product Name Alternative

Drg11, Drgx, Prrxl1

UniProt

Q62798

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrxl1 Rabbit Polyclonal Antibody (orb324661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665710

Preservative

Lyophilized powder

AA Sequence

GAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHPRH Mouse Monoclonal Antibody [Clone ID: OTI4F3]
TA501444S 30 µL

SHPRH Mouse Monoclonal Antibody [Clone ID: OTI4F3]

Sign In for Pricing
View Details
Nuclear Factor kB P65 (NFkBP65) Mouse ELISA Kit
F4611 96 Tests

Nuclear Factor kB P65 (NFkBP65) Mouse ELISA Kit

Sign In for Pricing
View Details
5-methyl-4,5,6,7-tetrahydro-1-benzothiophene-2-carboxylic acid
sc-284667 100 mg

5-methyl-4,5,6,7-tetrahydro-1-benzothiophene-2-carboxylic acid

Sign In for Pricing
View Details
Rabbit Polyclonal SLC36A4 Antibody [Alexa Fluor 532]
NBP2-98630AF532 0.1 mL

Rabbit Polyclonal SLC36A4 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
hsa-miR-562 miRNA Antagomir
MNH03107 2x 5.0 nmol

hsa-miR-562 miRNA Antagomir

Sign In for Pricing
View Details
MACROD2 Lentiviral Activation Particles (m2)
sc-428462-LAC-2 200 µL

MACROD2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details