Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Peptide - middle region

Prrxl1 Peptide - middle region

Product Specifications

Product Name Alternative

Drg11, Drgx, Prrxl1

UniProt

Q62798

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrxl1 Rabbit Polyclonal Antibody (orb324661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665710

Preservative

Lyophilized powder

AA Sequence

GAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3gnt3 Rat shRNA Plasmid (Locus ID 290638)
TL704660 1 Kit

B3gnt3 Rat shRNA Plasmid (Locus ID 290638)

Sign In for Pricing
View Details
Rat interleukin 1 receptorI ELISA Kit
GTR10316299 96 Well

Rat interleukin 1 receptorI ELISA Kit

Sign In for Pricing
View Details
Anti Mouse CD14 Flow Cytometry Monoclonal Clone SA142 ER780 Ready To Use 100 Tests
IRTAMSCD14SA142CER780100 100 Tests

Anti Mouse CD14 Flow Cytometry Monoclonal Clone SA142 ER780 Ready To Use 100 Tests

Sign In for Pricing
View Details
HS6ST1 Rabbit pAb, IRDye 800CW conjugated
orb2858566 100 µL

HS6ST1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
OR7A5 Human shRNA Plasmid Kit (Locus ID 26659)
TL302764 1 Kit

OR7A5 Human shRNA Plasmid Kit (Locus ID 26659)

Sign In for Pricing
View Details
TRIP10 Antibody
A56012-50UG 50 µg

TRIP10 Antibody

Sign In for Pricing
View Details