Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Peptide - middle region

Prrxl1 Peptide - middle region

Product Specifications

Product Name Alternative

Drg11, Drgx, Prrxl1

UniProt

Q62798

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrxl1 Rabbit Polyclonal Antibody (orb324661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665710

Preservative

Lyophilized powder

AA Sequence

GAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nip30 Protein Vector (Human) (pPM-C-HA)
PV028319 500 ng

Nip30 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
1-Methyl-4-sulfopyridinium hydroxide inner salt
EAA41669-01 1 mg

1-Methyl-4-sulfopyridinium hydroxide inner salt

Sign In for Pricing
View Details
1-Methyl-4-sulfopyridinium hydroxide inner salt
EAA41669-02 5 mg

1-Methyl-4-sulfopyridinium hydroxide inner salt

Sign In for Pricing
View Details
1-Methyl-4-sulfopyridinium hydroxide inner salt
EAA41669-03 10 mg

1-Methyl-4-sulfopyridinium hydroxide inner salt

Sign In for Pricing
View Details
1-Methyl-4-sulfopyridinium hydroxide inner salt
EAA41669-04 25 mg

1-Methyl-4-sulfopyridinium hydroxide inner salt

Sign In for Pricing
View Details
1-Methyl-4-sulfopyridinium hydroxide inner salt
EAA41669-05 50 mg

1-Methyl-4-sulfopyridinium hydroxide inner salt

Sign In for Pricing
View Details