Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Relb Peptide - C-terminal region

Relb Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Relb Rabbit Polyclonal Antibody (orb329898) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_002728953

Preservative

Lyophilized powder

AA Sequence

DSYGVDKKRKRGLPDVLGELSSSDPHGIESKRRKKKPVFLDHFLPGHSSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfaquinoxaline-13C6
TRC-S689038-25MG 25 mg

Sulfaquinoxaline-13C6

Sign In for Pricing
View Details
IL8RB sgRNA CRISPR Lentivector set (Human)
K1077301 3x 1.0 µg

IL8RB sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human Cluster Of Differentiation 1d (CD1d)
RPU40814-01 50 µg

Recombinant Human Cluster Of Differentiation 1d (CD1d)

Sign In for Pricing
View Details
Recombinant Human Cluster Of Differentiation 1d (CD1d)
RPU40814-02 100 µg

Recombinant Human Cluster Of Differentiation 1d (CD1d)

Sign In for Pricing
View Details
Recombinant Human Cluster Of Differentiation 1d (CD1d)
RPU40814-03 1 mg

Recombinant Human Cluster Of Differentiation 1d (CD1d)

Sign In for Pricing
View Details
GABPB2 Rabbit pAb, PerCP-Cy7 conjugated
orb2870519 100 µL

GABPB2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details