Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nkx3-1 Peptide - middle region

Nkx3-1 Peptide - middle region

Product Specifications

Product Name Alternative

Bax, NKX3.1, NKX3A, Nkx-3.1, bagpipe

UniProt

P97436

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nkx3-1 Rabbit Polyclonal Antibody (orb576216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035051

Preservative

Lyophilized powder

AA Sequence

TPTEPESDAHFETYLLDCEHNPGDLASAPQVTKQPQKRSRAAFSHTQVIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF652 (NM_001145365) Human Over-expression Lysate
LY428846 100 µg

ZNF652 (NM_001145365) Human Over-expression Lysate

Sign In for Pricing
View Details
Collagen VI (COL6A1) Rabbit Monoclonal Antibody
TA422794 100 µL

Collagen VI (COL6A1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CBF1 interacting corepressor (CIR1) Rabbit Polyclonal Antibody
TA367943 100 µL

CBF1 interacting corepressor (CIR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3078), CF405S conjugate, 0.1mg/mL
BNC043078-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3078), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DDX3X Antibody
KC-6172-01 50 μL

DDX3X Antibody

Sign In for Pricing
View Details
DDX3X Antibody
KC-6172-02 100 µL

DDX3X Antibody

Sign In for Pricing
View Details