Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nkx3-1 Peptide - middle region

Nkx3-1 Peptide - middle region

Product Specifications

Product Name Alternative

Bax, NKX3.1, NKX3A, Nkx-3.1, bagpipe

UniProt

P97436

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nkx3-1 Rabbit Polyclonal Antibody (orb576216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035051

Preservative

Lyophilized powder

AA Sequence

TPTEPESDAHFETYLLDCEHNPGDLASAPQVTKQPQKRSRAAFSHTQVIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAFAH1B2 Polyclonal Antibody
E-AB-90364-01 60 µL

PAFAH1B2 Polyclonal Antibody

Sign In for Pricing
View Details
PAFAH1B2 Polyclonal Antibody
E-AB-90364-02 120 µL

PAFAH1B2 Polyclonal Antibody

Sign In for Pricing
View Details
PAFAH1B2 Polyclonal Antibody
E-AB-90364-03 200 µL

PAFAH1B2 Polyclonal Antibody

Sign In for Pricing
View Details
KLC2 (NM_022822) Human Over-expression Lysate
LC402950 20 µg

KLC2 (NM_022822) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Prenylcysteine Oxidase 1 (PCYOX1) ELISA Kit
RDR-PCYOX1-Mu-01 96 Tests

Mouse Prenylcysteine Oxidase 1 (PCYOX1) ELISA Kit

Sign In for Pricing
View Details
Mouse Prenylcysteine Oxidase 1 (PCYOX1) ELISA Kit
RDR-PCYOX1-Mu-02 48 Tests

Mouse Prenylcysteine Oxidase 1 (PCYOX1) ELISA Kit

Sign In for Pricing
View Details