Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Helt Peptide - C-terminal region

Helt Peptide - C-terminal region

Product Specifications

Product Name Alternative

A830086M02, Hesl, Mgn, megane

UniProt

Q7TS99

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Helt Rabbit Polyclonal Antibody (orb576335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776150

Preservative

Lyophilized powder

AA Sequence

LPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKRD15 (KANK1) activation kit by CRISPRa
GA108108 1 Kit

Human ANKRD15 (KANK1) activation kit by CRISPRa

Sign In for Pricing
View Details
IsoPure™ Mini, Automated Purification System, 115V
AP1016 1 Each

IsoPure™ Mini, Automated Purification System, 115V

Sign In for Pricing
View Details
TALDO1 Antibody
KC-29596-01 50 μL

TALDO1 Antibody

Sign In for Pricing
View Details
TALDO1 Antibody
KC-29596-02 100 µL

TALDO1 Antibody

Sign In for Pricing
View Details
TALDO1 Antibody
KC-29596-03 1 mL

TALDO1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS633498 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details