Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Helt Peptide - C-terminal region

Helt Peptide - C-terminal region

Product Specifications

Product Name Alternative

A830086M02, Hesl, Mgn, megane

UniProt

Q7TS99

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Helt Rabbit Polyclonal Antibody (orb576335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776150

Preservative

Lyophilized powder

AA Sequence

LPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYH (MUTYH) Human Gene Knockout Kit (CRISPR)
KN201376BN 1 Kit

MYH (MUTYH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
n-Docosane-d46
TRC-D678806-500MG 500 mg

n-Docosane-d46

Sign In for Pricing
View Details
Frozen Tissue Blocks, Endometrium
CB617309 1 Block

Frozen Tissue Blocks, Endometrium

Sign In for Pricing
View Details
SCN2B (N-term) Rabbit Polyclonal Antibody
AP08900PU-N 50 µg

SCN2B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PKC beta 1 (PRKCB) Goat Polyclonal Antibody
AP32819PU-N 100 µg

PKC beta 1 (PRKCB) Goat Polyclonal Antibody

Sign In for Pricing
View Details
PNMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]
TA502823BM 100 µL

PNMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]

Sign In for Pricing
View Details