Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irak1bp1 Peptide - C-terminal region

Irak1bp1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4921528N06Rik, AI851240, Aabp3, Aip70, Simpl

UniProt

Q9ESJ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Irak1bp1 Rabbit Polyclonal Antibody (orb585390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075362

Preservative

Lyophilized powder

AA Sequence

WEGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C6orf97 (CCDC170) activation kit by CRISPRa
GA112827 1 Kit

Human C6orf97 (CCDC170) activation kit by CRISPRa

Sign In for Pricing
View Details
DNAH5 Antibody
KC-34364-01 50 μL

DNAH5 Antibody

Sign In for Pricing
View Details
DNAH5 Antibody
KC-34364-02 100 µL

DNAH5 Antibody

Sign In for Pricing
View Details
DNAH5 Antibody
KC-34364-03 1 mL

DNAH5 Antibody

Sign In for Pricing
View Details
PBD-5,11-dione
TRC-P344510-250MG 250 mg

PBD-5,11-dione

Sign In for Pricing
View Details
SRRM3 Human Gene Knockout Kit (CRISPR)
KN426066 1 Kit

SRRM3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details