Irak1bp1 Peptide - C-terminal region
Irak1bp1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
4921528N06Rik, AI851240, Aabp3, Aip70, Simpl
UniProt
Q9ESJ7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Irak1bp1 Rabbit Polyclonal Antibody (orb585390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_075362
Preservative
Lyophilized powder
AA Sequence
WEGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401960-500 1x 500 µL
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040685-500 1x 500 µL
CD68 (C68/684 + KP1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040970-500 1x 500 µL
GLG1 (Golgi Complex) (GLG1/970), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741992-500 1x 500 µL
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details