Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP58 Peptide - middle region

NUP58 Peptide - middle region

Product Specifications

Product Name Alternative

Nup45, Nupl1, p58/p45

UniProt

P70581

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUP58 Rabbit Polyclonal Antibody (orb585457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620791

Preservative

Lyophilized powder

AA Sequence

GGIDFSTSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD5 Polyclonal Antibody
E-AB-67804-01 60 µL

PSMD5 Polyclonal Antibody

Sign In for Pricing
View Details
PSMD5 Polyclonal Antibody
E-AB-67804-02 120 µL

PSMD5 Polyclonal Antibody

Sign In for Pricing
View Details
PSMD5 Polyclonal Antibody
E-AB-67804-03 200 µL

PSMD5 Polyclonal Antibody

Sign In for Pricing
View Details
Safinamide R-Isomer Impurity
TRC-F174755-500MG 500 mg

Safinamide R-Isomer Impurity

Sign In for Pricing
View Details
Mouse Nfil3 activation kit by CRISPRa
GA202881 1 Kit

Mouse Nfil3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human RNF123 activation kit by CRISPRa
GA111898 1 Kit

Human RNF123 activation kit by CRISPRa

Sign In for Pricing
View Details