Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP58 Peptide - middle region

NUP58 Peptide - middle region

Product Specifications

Product Name Alternative

Nup45, Nupl1, p58/p45

UniProt

P70581

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUP58 Rabbit Polyclonal Antibody (orb585457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620791

Preservative

Lyophilized powder

AA Sequence

GGIDFSTSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Palbociclib
TRC-P139900-50MG 50 mg

Palbociclib

Sign In for Pricing
View Details
LT-alpha Mouse Monoclonal Antibody [C2-F2]
M0807-12 100 µL

LT-alpha Mouse Monoclonal Antibody [C2-F2]

Sign In for Pricing
View Details
Deterenol Hydrochloride
TRC-D297950-25MG 25 mg

Deterenol Hydrochloride

Sign In for Pricing
View Details
TRAIL (TNFSF10) Mouse Monoclonal Antibody [Clone ID: B-S23]
AM31199BT-N 1 mL (100 Tests)

TRAIL (TNFSF10) Mouse Monoclonal Antibody [Clone ID: B-S23]

Sign In for Pricing
View Details
Human ZNF517 activation kit by CRISPRa
GA117476 1 Kit

Human ZNF517 activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene AM Ramage
H10025.50G 50 g

Polystyrene AM Ramage

Sign In for Pricing
View Details