Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snx12 Peptide - C-terminal region

Snx12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1565585

UniProt

D4A719

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Snx12 Rabbit Polyclonal Antibody (orb331201) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102287

Preservative

Lyophilized powder

AA Sequence

SKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3FA (HIST1H3A) Rabbit Monoclonal Antibody
TA424107 100 µL

H3FA (HIST1H3A) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI12C6]
CF813255 100 µg

CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI12C6]

Sign In for Pricing
View Details
Recombinant Human CD97 Protein (His Tag)
PKSH031169 100 µg

Recombinant Human CD97 Protein (His Tag)

Sign In for Pricing
View Details
Human SKT (KIAA1217) activation kit by CRISPRa
GA111159 1 Kit

Human SKT (KIAA1217) activation kit by CRISPRa

Sign In for Pricing
View Details
Human DLK2 activation kit by CRISPRa
GA112272 1 Kit

Human DLK2 activation kit by CRISPRa

Sign In for Pricing
View Details
TIMP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B11]
TA504044BM 100 µL

TIMP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B11]

Sign In for Pricing
View Details