Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snx12 Peptide - C-terminal region

Snx12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1565585

UniProt

D4A719

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Snx12 Rabbit Polyclonal Antibody (orb331201) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102287

Preservative

Lyophilized powder

AA Sequence

SKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTFR1L (NM_001099625) Human Over-expression Lysate
LC420464 20 µg

MTFR1L (NM_001099625) Human Over-expression Lysate

Sign In for Pricing
View Details
MemBrite® Fix 680/700 Cell Surface Staining Kit, 500 Reactions
#30099 1 Kit

MemBrite® Fix 680/700 Cell Surface Staining Kit, 500 Reactions

Sign In for Pricing
View Details
AIRE (102-115) Goat Polyclonal Antibody
AP08253PU-N 50 µg

AIRE (102-115) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS510237 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Recombinant USP20 Antibody
RN-14710-01 50 μL

Recombinant USP20 Antibody

Sign In for Pricing
View Details
Recombinant USP20 Antibody
RN-14710-02 100 µL

Recombinant USP20 Antibody

Sign In for Pricing
View Details