Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube2z Peptide - C-terminal region

Ube2z Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1308347

UniProt

Q3B7D1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ube2z Rabbit Polyclonal Antibody (orb585477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032732

Preservative

Lyophilized powder

AA Sequence

ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LETMD1 Antibody
CSB-PA012879KA01HU-100ul 100 µL

LETMD1 Antibody

Sign In for Pricing
View Details
PRR35 (NM_145270) Human Over-expression Lysate
LS146325-20ug 20 µg

PRR35 (NM_145270) Human Over-expression Lysate

Sign In for Pricing
View Details
MIRacle™ rno-miR-3586-3p miRNA Agomir/Antagomir
AM4774 2 OD, 4 OD, 50 OD

MIRacle™ rno-miR-3586-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Monomethyl auristatin F (MMAF) 200mg
A13955-200 200 mg

Monomethyl auristatin F (MMAF) 200mg

Sign In for Pricing
View Details
Duck plague virus Rabbit Polyclonal Antibody (Cy3)
orb983288 100 µL

Duck plague virus Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
PECAM-1 Antibody
orb2311695-01 20 µg

PECAM-1 Antibody

Sign In for Pricing
View Details