Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rap1a Peptide - C-terminal region

Rap1a Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI848598, G-22K, Krev-1, Rap1

UniProt

P62835

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rap1a Rabbit Polyclonal Antibody (orb585638) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663516

Preservative

Lyophilized powder

AA Sequence

GQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEOX1 Over-expression Lysate Product
GWB-3829B5 0.1 mg

MEOX1 Over-expression Lysate Product

Sign In for Pricing
View Details
Cyp2f2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3365606 1.0 µg DNA

Cyp2f2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae DNA-directed RNA polymerase III subunit RPC5 (RPC37)
MBS1052461-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae DNA-directed RNA polymerase III subunit RPC5 (RPC37)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae DNA-directed RNA polymerase III subunit RPC5 (RPC37)
MBS1052461-02 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae DNA-directed RNA polymerase III subunit RPC5 (RPC37)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae DNA-directed RNA polymerase III subunit RPC5 (RPC37)
MBS1052461-03 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae DNA-directed RNA polymerase III subunit RPC5 (RPC37)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae DNA-directed RNA polymerase III subunit RPC5 (RPC37)
MBS1052461-04 0.1 mg (Yeast)

Recombinant Saccharomyces cerevisiae DNA-directed RNA polymerase III subunit RPC5 (RPC37)

Sign In for Pricing
View Details