Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rap1a Peptide - C-terminal region

Rap1a Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI848598, G-22K, Krev-1, Rap1

UniProt

P62835

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rap1a Rabbit Polyclonal Antibody (orb585638) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663516

Preservative

Lyophilized powder

AA Sequence

GQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aluminium Sulfate
01804-05 500 g

Aluminium Sulfate

Sign In for Pricing
View Details
Recombinant Human Palate/Lung And Nasal Epithelium Associated Protein (PLUNC)
RPU56006-01 50 µg

Recombinant Human Palate/Lung And Nasal Epithelium Associated Protein (PLUNC)

Sign In for Pricing
View Details
Recombinant Human Palate/Lung And Nasal Epithelium Associated Protein (PLUNC)
RPU56006-02 100 µg

Recombinant Human Palate/Lung And Nasal Epithelium Associated Protein (PLUNC)

Sign In for Pricing
View Details
Recombinant Human Palate/Lung And Nasal Epithelium Associated Protein (PLUNC)
RPU56006-03 1 mg

Recombinant Human Palate/Lung And Nasal Epithelium Associated Protein (PLUNC)

Sign In for Pricing
View Details
IL-6R Protein, Mouse, Recombinant (His Tag)
E45M53323M2-50 50 µg

IL-6R Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
BCAS2, NT (BCAS2, DAM1, Pre-mRNA-splicing factor SPF27, Breast carcinoma-amplified sequence 2, DNA amplified in mammary carcinoma 1 protein, Spliceosome-associated protein SPF 27) (MaxLight 750) discontinued
032446-ML750 100 µL

BCAS2, NT (BCAS2, DAM1, Pre-mRNA-splicing factor SPF27, Breast carcinoma-amplified sequence 2, DNA amplified in mammary carcinoma 1 protein, Spliceosome-associated protein SPF 27) (MaxLight 750) discontinued

Sign In for Pricing
View Details