Dlg3 Peptide - middle region
Dlg3 Peptide - middle region
Product Specifications
Product Name Alternative
Dlgh3, SAP102, mKIAA1232
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dlg3 Rabbit Polyclonal Antibody (orb326472) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001171251
Preservative
Lyophilized powder
AA Sequence
FGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-THRa-Ra-01 96 Tests
Rat Thyroid Hormone Receptor Alpha (THRa) ELISA Kit
Sign In for Pricing
View Details RDR-THRa-Ra-02 48 Tests
Rat Thyroid Hormone Receptor Alpha (THRa) ELISA Kit
Sign In for Pricing
View Details 
BNC041911-500 1x 500 µL
ROR2 (ROR2/1911), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
