Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dlg3 Peptide - middle region

Dlg3 Peptide - middle region

Product Specifications

Product Name Alternative

Dlgh3, SAP102, mKIAA1232

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dlg3 Rabbit Polyclonal Antibody (orb326472) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171251

Preservative

Lyophilized powder

AA Sequence

FGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC II (HLA-DQ) (SPV-L3), CF555 conjugate, 0.1mg/mL
BNC550200-100 1x 100 µL

MHC II (HLA-DQ) (SPV-L3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ProS1 Protein, His Tag
PR1-H52H4-100ug 100 µg

Human ProS1 Protein, His Tag

Sign In for Pricing
View Details
PerCP Anti-Human CD3 Antibody[UCHT1]
E-AB-F1230F-01 20 Tests

PerCP Anti-Human CD3 Antibody[UCHT1]

Sign In for Pricing
View Details
PerCP Anti-Human CD3 Antibody[UCHT1]
E-AB-F1230F-02 100 Tests

PerCP Anti-Human CD3 Antibody[UCHT1]

Sign In for Pricing
View Details
PerCP Anti-Human CD3 Antibody[UCHT1]
E-AB-F1230F-03 2x 100 Tests

PerCP Anti-Human CD3 Antibody[UCHT1]

Sign In for Pricing
View Details
Sdccag8 Mouse Gene Knockout Kit (CRISPR)
KN515425 1 Kit

Sdccag8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details