Grb14 Peptide - middle region
Grb14 Peptide - middle region
Product Specifications
UniProt
O88900
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Grb14 Rabbit Polyclonal Antibody (orb585705) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_113811
Preservative
Lyophilized powder
AA Sequence
KAYFFLRRSGLYFSTKGTSKEPRHLQFFSEFSTSNVYMSLAGKKKHGAPT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#30092 1 Kit
MemBrite® Fix 405/430 Cell Surface Staining Kit, 500 Reactions
Sign In for Pricing
View Details 
BNC472775-100 1x 100 µL
Vimentin (Mesenchymal Cell Marker) (V9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681120-500 1x 500 µL
Ep-CAM / CD326 (EGP40/1120), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-H593508-25MG 25 mg
Homoglutathione H-Glu(Cys-b-Ala-OH)-OH TFA Salt
Sign In for Pricing
View Details 