Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grb14 Peptide - middle region

Grb14 Peptide - middle region

Product Specifications

UniProt

O88900

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Grb14 Rabbit Polyclonal Antibody (orb585705) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113811

Preservative

Lyophilized powder

AA Sequence

KAYFFLRRSGLYFSTKGTSKEPRHLQFFSEFSTSNVYMSLAGKKKHGAPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Morniga G Lectin (black mulberry) -MNA-G-,  5nm
GP-9005-5 1 mL

Colloidal Gold Conjugated Morniga G Lectin (black mulberry) -MNA-G-, 5nm

Sign In for Pricing
View Details
TATA binding protein (TBP) (NM_003194) Human Over-expression Lysate
LY401105 100 µg

TATA binding protein (TBP) (NM_003194) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Human CD45 Antibody[HI30]
E-AB-F1137T3-01 20 Tests

Elab Fluor® Violet 540 Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Human CD45 Antibody[HI30]
E-AB-F1137T3-02 100 Tests

Elab Fluor® Violet 540 Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Human CD45 Antibody[HI30]
E-AB-F1137T3-03 2x 100 Tests

Elab Fluor® Violet 540 Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
3,3',3''-(Propane-1,2,3-triyltris(oxy))tris(propan-1-ol)
TRC-P388290-500MG 500 mg

3,3',3''-(Propane-1,2,3-triyltris(oxy))tris(propan-1-ol)

Sign In for Pricing
View Details