Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRTN Peptide - middle region

SPRTN Peptide - middle region

Product Specifications

Product Name Alternative

C1orf124, DDDL1880, PRO4323, Spartan, dJ876B10.3

UniProt

Q9H040

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPRTN Rabbit Polyclonal Antibody (orb326824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114407

Preservative

Lyophilized powder

AA Sequence

ATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Mouse Beta-defensin 14 (Defb14) ELISA
KLM1206 1x 96 Well

GENLISA™ Mouse Beta-defensin 14 (Defb14) ELISA

Sign In for Pricing
View Details
STT3A ORF Vector (Human) (pORF)
45784011 1.0 µg DNA

STT3A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human GDI1 Protein, N-His
AP91419 50 µg

Recombinant Human GDI1 Protein, N-His

Sign In for Pricing
View Details
Xpress™ Human ETF1 Over-expressing Stable Cell Line
ABC-X1008 1 Vial

Xpress™ Human ETF1 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
D6PKL1 Antibody
orb786973 2 mg

D6PKL1 Antibody

Sign In for Pricing
View Details
3-Bromo-4- (3'-methoxyphenyl) pyridine
OR8276 1 Each

3-Bromo-4- (3'-methoxyphenyl) pyridine

Sign In for Pricing
View Details